SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD036584 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD036584
Domain Number - Region: 110-222,251-287
Classification Level Classification E-value
Superfamily TPR-like 0.0252
Family Transcription factor MalT domain III 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD036584
Sequence length 536
Comment 536
Sequence
MAARPIAKAAHELPSLYRLALKTPEILVGAGKSGQADNEALDLFDGMPPKNQVAWNKALG
MLVGAGRIERALSFFHEMPGKNAASYATMIGGLSRAGAASVARRLFDDLPLGKHNVFTWT
AMVSCHVRNGEPREAVQLFAAFYGELYERGVLPNAHTLSSLLKACVALQSLAMATQLHAL
ALKLLEEENTDNTFVWNGLIDVHAKVGALCDAEKVFDGMRFKDASSWTIMMDGYSRHKLI
DKALYLFRSMKNKDAFTWNVIISCLWQNRRGEDALRLFIDLLRLGDRDNGGAKPDASIYT
TVLHICSVLSLLTLGRQVHARAVKSGLSRSHVFVGNSLMNMYSCSGSTADLEKVFDEMAA
RDVVSWNTAIQGLGQNGRGRRALAFAERALALGLYNGSTFVAILASCSHAELVAEGMAYF
DAMEVEYGVERAFEHYVGAIDLLGRAGRLRDAHGLLLGMPFAPSALAWTTLLHCCLAHKN
CSIGSVAARELRALQPDGGGWNYERLLRGCGGGGGGGGEAGGGKSSEHLPGCSWVV
Download sequence
Identical sequences A2WS00
39946.BGIOSIBCE002544 OsIBCD036584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]