SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD036695 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD036695
Domain Number 1 Region: 50-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.92e-17
Family Thioltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD036695
Sequence length 147
Comment 147
Sequence
MYQAIPYSSTRPWLRPEPAASVVDVVKVETTTAVAGRGGEAEVVGEEEAAEVRRAVAESP
VLVVGRRGCCLIHVVKRLLQGLGVNPAVHEVAGEAALKGVVPAGGEAAALPAVFVGGKLL
GGLDRLMAVHISGELVPILKKAGALWL
Download sequence
Identical sequences A0A0E0FQQ5 A0A0E0N0G5 A2WTL1 I1NQH8 Q5QLR2
39946.BGIOSIBCE003104 39947.LOC_Os01g47760.1 LOC_Os01g47760.1|PACid:21907277 LOC_Os01g47760.1|13101.m04945|protein XP_015624046.1.37577 ORGLA01G0211800.1 OsIBCD036695 ONIVA01G29110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]