SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD036988 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD036988
Domain Number 1 Region: 103-192
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-19
Family Thioltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD036988
Sequence length 255
Comment 255
Sequence
MWLPWVKTRPSSPSSAAASPSPSTALAAAAASPRLSFSSPSLKDLQALLLSDHSPSPTPP
QLPPNTAPCSPSVRVFHRVRVAASALRALRTLQAPHAAAAEADRRVVLYFTSLHVVRSTY
EDCRAVRAILRGLRASVDERDLAMDPRYLQELGALLPRARGVTLPQVFVGGRHLGGAEEV
RRLHESGELRRVVAGAGATAFAACSRCGGERYVLCGSCNGSHKRYSLKGGGGFRTCAGCN
ENGLVRCPDCSPPAV
Download sequence
Identical sequences A0A0E0FV96 A2WWL3 I1NSZ3
ORGLA01G0298300.1 OsIBCD036988 39946.BGIOSIBCE004141 ONIVA01G40900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]