SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD037056 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037056
Domain Number 1 Region: 20-120
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-30
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037056
Sequence length 149
Comment 149
Sequence
MGAGASSADTDTTGGVEFWRSPERAGWLTKQGEYIKTWRRRWFVLKQGRLFWFKDSGVTR
ASVPRGVIPVATCLTVKGAEDTLNRQFAFELSTPAETMYFIADSEKEKEEWINSIGRSIV
QHSRSVTDAEIVDYDSGRPAASVAADGDK
Download sequence
Identical sequences 39946.BGIOSIBCE004324 OsIBCD037056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]