SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD037185 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037185
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.49e-22
Family Thioltransferase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037185
Sequence length 104
Comment 104
Sequence
MAERVARLSSQRAVVIFGASNCFMCHVVKTLFSELGVSWAVHEVDKDPNGKDVERALAGM
VGRTPPVPAVFIGGKLVGPTDQVMSLHLAGKLVPLLREAGALWL
Download sequence
Identical sequences A0A0D3EYE5 A0A0D9YJR8 A0A0E0FYH3 A0A0E0N7C6 A2WYT9
OsIBCD037185 ONIVA01G49150.1 OBART01G43220.1 OGLUM01G47520.1 39946.BGIOSIBCE004895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]