SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD037201 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037201
Domain Number 1 Region: 4-58
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.000000000221
Family Cellulases catalytic domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037201
Sequence length 123
Comment 123
Sequence
MLSFHSAAGGESHDLDGTVVGGPNGNDVFTDHRGAYLQTEACTYNTAAMVGVFSKLMEVE
VERDASVRSAYAAGDAQADLKTLVDGLVANGNTNIKVDAGTHPQTATGHGRLLCSQRSCN
IPA
Download sequence
Identical sequences OsIBCD037201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]