SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD037218 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037218
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.94e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037218
Sequence length 114
Comment 114
Sequence
MADPVKLIGAFGSPFVHRAEVALRLKGVAYEFIHEDLDNKSDLLLAKNPIHKKVPVLLHG
DRAICESLVIVEYADEVFDGRPILPTDPYDRAMARFWAHFIEHKAIYIIVVDNL
Download sequence
Identical sequences A2WZ36
39946.BGIOSIBCE004994 OsIBCD037218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]