SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD037744 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037744
Domain Number 1 Region: 90-315
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000000000141
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037744
Sequence length 355
Comment 355
Sequence
MAPELSSPSSSPRYTVGYALLPEKVSSVVRPSLVALAADRGVRLVAVDVSRPLAEQGPFD
LLVHKMYDRGWRAQLEELAARHPGVPVVVDSPGAIDRLLDRATMLDVVSGLRTPVSVPPQ
VVVSDAAADADELLARAALRFPLIAKPLAVDGSAESHDMRLVYRRDGVLPLLRAPLVLQE
FVNHGGVLFKVYVVGDRATCVRRSSLPDVPARRLLDLDAEPSVPFANISNQPLPPPDDDG
GAADDDTPAAGFVDEVARGLRRGLGLHLFNFDMIRERSEEHGDRYFIIDINYFPGYAKMP
GYEAALTDFFLEMLRGTRPVPEQLGPGSGLDMEARKLEPGLGIGLRELESGRAQA
Download sequence
Identical sequences A0A0E0IBC5 A0A0E0NEM2 A2X4M8
ONIVA08G14210.1 OsIBCD037744 39946.BGIOSIBCE006911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]