SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD039075 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD039075
Domain Number - Region: 38-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0731
Family Thioltransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD039075
Sequence length 336
Comment 336
Sequence
MESPSHPLLLLLTLLVAAGAASAGADDLVAELQSLRSRSPSGVIHLTDTSITRFLSAPAP
RPYSVLVFFDAASLHSKTDLHLPQLRREFALLSASFLAHNPASADLFFADIEFSESQHSF
AQFGVNSLPHVRLVRPEHTRLAGSEQMDQSHFSRLADSMAEFVESRTGLEVGPIVRPPLV
SRNQMILLVILFLVSIPFLIKRIMDGETLFHDRRVWMAGALFIYFFSVSGGMYGIIRHTP
MFITDRSDPNKLVFFYQGSGMQLGAEGFAVGFLYTLVGLMIAMVTHLLVRVESLQIQRFT
MLAVMIIGWWAVKKVILLDNWKTGYSIHTFWPSSWR
Download sequence
Identical sequences B8AKU1
39946.BGIOSIBCE011775 OsIBCD039075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]