SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD039114 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD039114
Domain Number 1 Region: 138-178,221-252,354-505
Classification Level Classification E-value
Superfamily TPR-like 0.0000354
Family Transcription factor MalT domain III 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD039114
Sequence length 653
Comment 653
Sequence
MPLLLPPPTPTPPCASRDPLHAAPRRSRSPSTSRPPSRHRCTASARSTLPAAARDLLADD
PTPRAFSALLKAASSSASPPRRPSSLGLGAQLHAQAVVRGFLGGDDSTILATAVLSFYAS
CREPDLARKVFDGMPRRNAVTWNALIKGYAQAGRREEAILLFRDMKREGSHVAPDRYTFP
ALLSGIGREGGSGRTLELGGALHAHVIKAGLERDPFVGASLVSLYAARRTLEDAKVAFDQ
VGSSDPIVWSSMISAYVNCEEEEGALLIFFNMLCQDIKPTQFVYSTVFSVCGRMGILEMG
KQVHAHSLKSNTEKDAAMFNALLTMYSDCGCINDAQKVFSSNDCVNVISYNSMISALGQH
GYPKEALEHFRQMKFAGLMPDEVTLLNLISSFNHAGLVHEGLQMFNSMVDIEGIKPMYQH
YACVVDMLARSGEIGKAMKTINEMPFEAEAPLWRIVLGACSKHRDIETGKRIAEMLFEME
PYEATNYILLGNIYARLGRWTEAEKVRSLMGERGVYKDDAFSWIEMGQRTYRFGVDDRSH
PISREIYRNLDRLISTIKVAGYVPDISFAAHNIQRDRKEESLYYHCEKLAFAFGDLAAPS
GGTLRIMKNLRVCGDCHCAYKYFSLVTGREIILRDNQRFHHFNSGFCSCGDYW
Download sequence
Identical sequences A2XIW4
OsIBCD039114 39946.BGIOSIBCE011875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]