SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD039499 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD039499
Domain Number 1 Region: 97-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-40
Family Glutathione S-transferase (GST), C-terminal domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 6-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.42e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD039499
Sequence length 231
Comment 231
Sequence
MAEEKELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLL
HAGRPVSESLVILQYLDDAFPGTPHLLSPANSGDADAAYARATARFWADYVDRKLYDCGS
RLWRLKGEPQAAAGREMAEILRTLEAELGDREFFGGGGGGRLGFVDVALVPFTAWFYSYE
RCGGFSVEEVAPRLAAWARRCGRIDSVAKHLPSPEKVYDFVGVLKKKYGVE
Download sequence
Identical sequences A2XMN2
OsIBCD039499 39946.BGIOSIBCE013198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]