SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD040077 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD040077
Domain Number 1 Region: 30-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.76e-22
Family Thioltransferase 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD040077
Sequence length 135
Comment 135
Sequence
MQYGAAAAEQAWYMPAAAMVVAAAAETAAERVERLASESAVVVFSVSSCCMCHAVKRLFC
GMGVHPAVHELDLDPRGRDLERALARLVGAGGAAAAAVPVVFIGGKLVGAMDRVMAAHIN
GSLVPLLKEAGALWL
Download sequence
Identical sequences A0A0E0H005 A2XSW3 Q01LB4 Q0JDM4
LOC_Os04g32300.1|PACid:21896414 LOC_Os04g32300.1|13104.m03092|protein ONIVA04G08700.1 OsIBCD040077 XP_015635298.1.37577 39946.BGIOSIBCE014983 39947.LOC_Os04g32300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]