SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD040102 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD040102
Domain Number 1 Region: 299-392
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.86e-21
Family Thioltransferase 0.028
Further Details:      
 
Weak hits

Sequence:  OsIBCD040102
Domain Number - Region: 398-447
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0942
Family DnaJ/Hsp40 cysteine-rich domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD040102
Sequence length 448
Comment 448
Sequence
MGCISSKLLPPGPGDARGGSGARATVRGRVDHVVSLTSTTYGVLDLHPKHGAAAAAAAAA
AAAAAVACQEKVQETQAQPPQEDKPISREWKRARPPPLVVPSAKKPAPAGKLDSGLEVIN
AWEIMAGLEDADAADASPAKKPAKQPSRWSPARVIAMALPSPKKSATKRRNTPGKENSPL
QRCSGNNNSSNINKTGDVNVDRVLRPYNSIDNSKLSRMSKRFSPVSARIVRKPGPPETGG
GMSSSRRSLSPLFDPELLASIERELSEEGAHIKRMVGSEKPKHPKAAPPAMVAEGKCPPG
GADAVVLYTTTLRGIRRTFEECNAVRAAIEAHDVKLIERDVSMDSGYREELRLLLGGREV
RVPAVFVRGRHVGGAAEVTKLEEEGKLKALLQGLPRARVWCAGCAGVRFVMCRDCNGSRK
VRVDGERKETVQCGECNENGLVRCPICS
Download sequence
Identical sequences A0A0E0P8W8 A2XT77 I1PL23 Q7XVH0
LOC_Os04g33680.1|PACid:21895948 XP_015635004.1.37577 OsIBCD040102 LOC_Os04g33680.1|13104.m03263|protein 39946.BGIOSIBCE015098 39947.LOC_Os04g33680.1 ORGLA04G0089200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]