SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD040145 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD040145
Domain Number - Region: 53-183
Classification Level Classification E-value
Superfamily TPR-like 0.000247
Family BTAD-like 0.089
Further Details:      
 
Domain Number - Region: 189-336
Classification Level Classification E-value
Superfamily TPR-like 0.00379
Family Transcription factor MalT domain III 0.088
Further Details:      
 
Domain Number - Region: 420-465
Classification Level Classification E-value
Superfamily TPR-like 0.00493
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD040145
Sequence length 655
Comment 655
Sequence
MVGAIQNLLRPFRCLLLRRFCSLGPPQRHAAGDVFQSNTAINEHFRAGRVAAARRVFDEM
SERNVFTWNCMVSGLIRNRMLAEARKVFDAMPVRNSVSWAALLTGYARCGRVAEARELFN
RIPDRNVVSWNAMVSGYARNGMVKRARELFDMMPWRDDVSWLTMISGYIKRKHVREAREL
FDSMPSPPTSVCNALLSGYVELGYMRAAEVLFGQMQTRNPVSWNVMITGYARAGSMGIAQ
RLFDEMPEKDVLSRTAIMRGYLQNGSVDAAWKVFKDMPHRDTVAWNTMMDGFVRNDRLDD
ALKLFSEMPDRDQISWHAILQGYVQQGDMDSANVWFPRAPNKDAISWNTLISGYKDEGAL
SLLSEMIRGGLKPDQATLSVVISICASLVSLGCGKMVHLWAIKTGFEHDALVMSSLISMY
SKCGLISEASQVFELILQRDTVTWNAMIATYAYHGLADEALKVFDMMTKAGFRPDHATFL
SILSACAHKGYLYEGCYHFRSMQEDWNLVPRSDHYSCMVDLLGRSGFIHQAYDFTRRIPS
DHRTTAWETLFSACNSHGEIQLGEIIARNVLKARPSDGGMYTLLSNIYAAKEMWSSAASV
RGFMKERGLKKETGCSWIELKGEVVTFSSNDSNHPLIEQICQEVDSISVMIEEAT
Download sequence
Identical sequences A2XTM0
39946.BGIOSIBCE015240 OsIBCD040145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]