SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD040262 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD040262
Domain Number 1 Region: 114-211
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.86e-19
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD040262
Sequence length 271
Comment 271
Sequence
MAAAAAATTRRMSRRRWPAERQEDARDLGAAEDEAAACYRRADTGKDKLFEPDLLAAFRG
AVDAYARALQEAKRRDDDDDDGFFLLDEEEGCGVAGGVGFGVDEDPLEGFETRCPPGGER
AVVLYTTSLRGVRKTFEDCATVRRLLEGLRVAFLERDVSMHAPYRDELRALLVGLDDAAV
PPRLFVDGRYLGGANEVVTLHEQARLRPVLRRAPRRGAGDAACAVCGGAWFVVCGACSGS
HRLYDAAAAAGGRVPCTGCNENGLVPCPLCS
Download sequence
Identical sequences A2XV08
39946.BGIOSIBCE015720 OsIBCD040262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]