SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD040531 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD040531
Domain Number 1 Region: 279-377
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-18
Family Thioltransferase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD040531
Sequence length 443
Comment 443
Sequence
MGCTNSTEARREMVLADAGRRATRSFSLPTVDRQRLRWKAVSMLSSLGISQGRRSGAFKY
ATTSVEGMMKSENDHAGQALLHVQEAAAKRAVIKPCTPTLTPPNEPEVINAWELMAGLED
DPPTPPCASHEPPAVTPQWMQADTDIPIVALDFDPEILSGFREALADTSPSEPTSCSVTE
EEEQPAQPEKHADACDAPTSLATGDMPEKRADACDAPISLATGDMPEKRADACDKTISLA
TGDMPELSGIVRARINAFQEKIERRSSKGARDAKVAHLRPPGGDKKAVVYFTSLRGVRKT
FVDCCSVRSILRSYGVRLDERDVSMHAVFRAELAELLGPGGFACAALPRVFVDGRYLGGA
EDVHALHEAAELARMLEGCEAAPVRKLGYMEACAACGDVRFVPCETCYGSCKIFVDDDVD
AGEFRRCPDCNENGLIRCPVCCC
Download sequence
Identical sequences A2XY45 Q9FSR1
OsIBCD040531 39946.BGIOSIBCE016784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]