SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD040809 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD040809
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.04e-18
Family Thioltransferase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD040809
Sequence length 112
Comment 112
Sequence
MLGLTLFDPPGGEQPAERIGRLVRESPVVIFARRGCCMCHVMRRLLAAVGAHATVIELDE
AAEEAAASAAAAAAVPALFVGGAPVGGLDGLMGLHLSGRLVPRLREVGALCG
Download sequence
Identical sequences 39946.BGIOSIBCE017875 OsIBCD040809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]