SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD040981 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD040981
Domain Number 1 Region: 616-729,768-899
Classification Level Classification E-value
Superfamily HCP-like 0.0000000157
Family HCP-like 0.031
Further Details:      
 
Domain Number 2 Region: 298-425,462-568
Classification Level Classification E-value
Superfamily HCP-like 0.00000262
Family HCP-like 0.033
Further Details:      
 
Weak hits

Sequence:  OsIBCD040981
Domain Number - Region: 221-314
Classification Level Classification E-value
Superfamily TPR-like 0.00863
Family Transcription factor MalT domain III 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD040981
Sequence length 939
Comment 939
Sequence
MPHGCHFLRPLSFTCRRRRLHSSLPRADGDGTEAGAATDTTLLGRFTRLLLLHRFPAAER
LLASSSPLTPALLQAALRRVRLDPDAALHLFRLAPSRPSLVSHAQLLHILARARRFHDAR
ALLSSLPPHAEPLFPHLAEVYRDFTFSAVSFDLLLRAHADAGQLSSALNVFDGMGKVGCR
PSLRSCNRLLNKLVQSGDPGMAAMVYGQMRIAGVLPDEFTVAIMAKAYCRDGRVAQAVEF
VEEMEGMGLEVNLVAYHAVMDCYCGMGWTEDARRILESLQRKGLSPNVVTYTLLVKGYCK
DGRMEEAERVVKEMKETGDIVVDEVAYGMMINGYCQRGRMDDATRVRNEMRDAGIHVNLF
VYNTMINGLCKLGRMEEVQKVLQEMEDVGMRPDKYSYNTLIDGYCREGSMRKAFEMCRMM
VRNGLAATTLTYNTLLKGFCSLHAIDDALRLWFLMLKRGVAPNEISCSTLLDGLFKAGKT
EQALNLWKETLARGLAKNVITFNTVINGLCKIGRMAEAEELLDRMKELRCPPDSLTYRTL
FDGYCKLGQLGTATHLMNKMEHLGFAPSVEMFNSFITGHFIAKQWHKVNDIHSEMSARGL
SPNLVTYGALIAGWCKEGNLHEACNLYFEMVNNGMNPNVFICSALMSCFYKEGKVDEANL
VLQKLVNIDMIPGCSISTIEIDKISHVVDTIADGNPHSANVMWNVIIFGLCKSGRIADAK
SLFESLRNKRFLPDNFTYSSLIHGCAASGSIDEAFSLRDVMLSAGLTPNIITYNSLIYGL
CKSGKLSRAVNLFNKLQSKGISPNGITYNTLIDEYCKEGKTTEAFKLKQKMVEEGIQPTV
ITYSILIYGLCTQGYMEEAIKLLDQMIENNVDPNYITYCTLIHGYIKSGNMEEISKLYDE
MHIRGLLPTNWIGNWKRSDPVVVNNWNRKDGHMKTYSQC
Download sequence
Identical sequences B8AW25 B9FNL7
OsIBCD040981 39946.BGIOSIBCE018332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]