SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD041257 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD041257
Domain Number 1 Region: 14-136
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-30
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD041257
Sequence length 172
Comment 172
Sequence
MAVSLWRAVMGAAGGGGSSSSSAAGGDAGGGVEFWHGGERTGWLNKQGEYIKTWRRRWFV
LKQGRLFWFKDAAVTRGSVPRGVIPVATCLTVKGAEDVINRQFAFELSTPTDTMYFIADS
EKEKEEWINSIGRSIVQHSRSVTDAEVVDYDSRPNSKTPPQPKTSEESEPSA
Download sequence
Identical sequences A0A0E0HF98 B8AYR7
ONIVA05G19310.1 OsIBCD041257 39946.BGIOSIBCE019233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]