SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD042625 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD042625
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.09e-24
Family Thioltransferase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD042625
Sequence length 127
Comment 127
Sequence
MRMQVVEAAAVEEAAAAAAMMSVYERVARMASGNAVVVFSASGCCMCHVVKRLLLGLGVG
PAVYELDQLAAAADIQAALSQLLPPGQPPVPVVFVGGRLLGGVEKVMACHINGTLVPLLK
QAGALWL
Download sequence
Identical sequences OsIBCD042625 39946.BGIOSIBCE023712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]