SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD044495 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD044495
Domain Number 1 Region: 88-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-43
Family Glutathione S-transferase (GST), C-terminal domain 0.00000832
Further Details:      
 
Domain Number 2 Region: 5-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD044495
Sequence length 228
Comment 228
Sequence
MADEVVLLDLWVSPFGQRCRIALAEKGVEYEYSEQSLADKSDLLLRSNPVHKKVPVLLHA
GRPVCESLVILEYIDETWPPEPEKKKESPRLLPSDPYARARARFWADYVDKKLFDCQTRL
WKLRAGDAAHEQAKRDMAEALGTLEAELGEGDYFGGEAFGYLDVVLVPFVAWFHAYERLA
GFAVAEICPRLVAWGERCKGRDSVAKTLTDPEKVYEFALYLKAKFGAK
Download sequence
Identical sequences A0A0E0IIG3 A0A0E0QQH9 A2Z0G6 Q9FUE5
XP_015612592.1.37577 39946.BGIOSIBCE029670 39947.LOC_Os09g20220.1 LOC_Os09g20220.1|13109.m01913|protein ONIVA09G06870.1 LOC_Os09g20220.1|PACid:21926004 OsIBCD044495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]