SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD044559 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD044559
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.43e-47
Family Cellulases catalytic domain 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD044559
Sequence length 149
Comment 149
Sequence
MTTSRQAYRVDRDNPGSDLAGETAAALAAASIVFRRSDPHYSHLLLHHAQQLFEFGDTYR
GSYDSSIEEVRSYYASVSGYHDELLWAALWLHRATGKEEYLRYAVDNADSFGGVGWAITE
FSWDVKYAGLQVLAAKVNLLNSSLTLRHA
Download sequence
Identical sequences A2Z0Z0
OsIBCD044559 39946.BGIOSIBCE029825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]