SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD045506 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD045506
Domain Number 1 Region: 78-227
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.43e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0000935
Further Details:      
 
Domain Number 2 Region: 14-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.63e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD045506
Sequence length 242
Comment 242
Sequence
MAEELKLLGSLSGVSPYVIRAQMALAVKGLAHDYLPEDLTRKSKLLLDSNPVHKSVPVLI
HNGKPVCDSLVIVEYVDEAFPGGAAALLPADPYHRAVARFWAAFIDSKVFPPCLAILKTA
AAEAEEKAAKVKETVEALQLVEGAFGECSKRKPFFGGDAVGYLDVVLGCYLCWFEGVSEI
AGGVSPPLLDASRTPQLAAWAARFRSAADAVGCSVPRVDKVEAYLNNVLKPKWSAAAAAS
SH
Download sequence
Identical sequences A2Z9M0
39946.BGIOSIBCE032857 OsIBCD045506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]