SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD045507 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD045507
Domain Number 1 Region: 78-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.09e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.81e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD045507
Sequence length 236
Comment 236
Sequence
MAGSGELKLLGVWSSPYAIRVRVVLNLKSLPYEYVEENLGDKSDLLLASNPVHKSVPVLL
HAGRPVNESQVIVQYIDEVWPGGAGGRPSVMPSDPYERAVARFWAAYVDDKVRPAWLAIL
FGSKTEEERAAAVAQAVAALETLEGAFGECSKGKPFFGGDGVGFVDVVLGGYLGWFTAID
KLIGRRLIDPARTPALAAWEERFRATDAAKGVVPDDADKLLEFRQTLLRWSASKAK
Download sequence
Identical sequences A0A0D3HFW9 A0A0E0F094 A2Z9M2 Q06398
OMERI10G13140.1 OsIBCD045507 XP_015614356.1.37577 LOC_Os10g38740.1|PACid:21884748 LOC_Os10g38740.1|13110.m03529|protein 39946.BGIOSIBCE032859 39947.LOC_Os10g38740.1 OBART10G16540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]