SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD046249 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD046249
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.27e-21
Family Thioltransferase 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD046249
Sequence length 108
Comment 108
Sequence
MERVAKLASERAVVVFTASNCGMCHAVTSLLVGELGVNAAVHELDKDPRGRDMERELARR
LNGGGGGGRAVPAVFVGGNLVGGANRVMSLHLAGELVPMLKNAGALWL
Download sequence
Identical sequences A2ZGI1
39946.BGIOSIBCE035207 OsIBCD046249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]