SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD046591 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD046591
Domain Number - Region: 3-90
Classification Level Classification E-value
Superfamily TPR-like 0.000126
Family Transcription factor MalT domain III 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD046591
Sequence length 116
Comment 116
Sequence
MLSRAGRLDEAEELVAAMPVHPDALIWGSLLAACRAHGEVERAERVMRRRTTDADADAGD
YVLMSNTYASNGRHGEAVKVRRQMRRNEIDKVPGCSLTKIDGVVNEFEAIPANSIR
Download sequence
Identical sequences B8BP48
39946.BGIOSIBCE036251 OsIBCD046591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]