SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD046799 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD046799
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-24
Family Thioltransferase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD046799
Sequence length 103
Comment 103
Sequence
MDRVMKLASERAVVIFTLSSCCMCHTVTRLFCDLGVNALVHELDQDPRGKEMERALLKLL
GRGPPVPVVFIGGKLVGGTNKIMSLHLGGELIPMLKNAGALWL
Download sequence
Identical sequences A0A0D3HVD1 A0A0E0BTP0 A0A0E0FNW2 A0A0E0RIB1 A2ZLA5 I1R6X6 Q0IMV4
OGLUM12G16200.1 OBART12G14690.1 LOC_Os12g35330.1|PACid:21934464 39946.BGIOSIBCE036837 39947.LOC_Os12g35330.1 XP_015619548.1.37577 ORGLA12G0128200.1 OsIBCD046799 ONIVA01G24030.1 LOC_Os12g35330.1|13112.m03614|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]