SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047089 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047089
Domain Number 1 Region: 52-109
Classification Level Classification E-value
Superfamily PH domain-like 0.000000109
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047089
Sequence length 172
Comment 172
Sequence
MSNLMHDYEVMSRISDLVGTLKCSYDDLSTSTTKNLLTAIQSSIQKKDEEMAWVDSCCLQ
LIARNKNGKEETFTFQTESPSIKKEWITELRLAQLALDANNSPAWIIPEHEQRPSTKMPL
FVEAHAVTKSNAHQQTEVSPIVSYTCERNIRVGRCALFPLNSEKATLVITKD
Download sequence
Identical sequences OsIBSD047089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]