SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047262 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047262
Domain Number 1 Region: 114-453
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 2.75e-106
Family Nqo4-like 0.000000195
Further Details:      
 
Domain Number 2 Region: 463-613
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.9e-48
Family NQO2-like 0.0017
Further Details:      
 
Domain Number 3 Region: 1-118
Classification Level Classification E-value
Superfamily Nqo5-like 1.03e-38
Family Nqo5-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047262
Sequence length 614
Comment 614
Sequence
MLKVALSEKDLHVPTATKVFPNAKWYERETWEMFGITFDGHPHLSRIMMPQTWEGHPLRK
DYPARATEFDPFVLTKQKEDLEMEALTFKPEDWGMKRGTENEDFMFLNLGPNHPSAHGAF
RIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNEMPYVLAV
EKLAGIKVPERVDTIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQKIYDLVE
AITGFRMHPAWFRIGGVAHDLPRGWDRLLREFLEWMPKRLDSYVKAALKNSILKGRSIGV
ASYNAKEALEWGVTGAGLRATGVEFDVRKWRPYSGYENFDFEVPVGDGNSDCYTRVMLKV
EELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVSWGPVMPAN
ESFQMIEATKGINSYYLTSDGSTMSYRTRVPAPQSGVDAFVLSAEERDAIEHEKHHYEDP
RAASIEALKIVQKQRGWVPDGAIYAIAEVLGIPASDVEGVATFYSQIFRQPVGRHVIRYC
DSVVCHITGYQGIQAAIEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKGPTMMIDDDTHSQ
LKPEDIETLLEQYQ
Download sequence
Identical sequences OsIBSD047262 39946.BGIOSIBSE038520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]