SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047530 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047530
Domain Number 1 Region: 208-342
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.23e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 138-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.19e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047530
Sequence length 347
Comment 347
Sequence
MTVNAFIGSWALVSSAFKNQNGELNYPLGEQVLGRIHYEANGTMAAQLYSAVRPRFVADD
LAQGSEREIHAAFINMICYFGRYQVEESEQRVVHQVEGCSFPNWIGSRQVRFYAFNADRL
TLRTVPLQLGNGVQIGELRILWFLEELGVPYQVQRYERDPHTLLAPPALKKIHPLGKSPV
IVDGDLTLAESGAIIEYLQEAYDAQGMFMPTDFHARQQYRYWLHYAEGSLMPLLVMKLVF
SRLGQPPIPWLLRPVAGAIGKGVQREYLDKQIAPHCEYLEQHLNKGSWFVGNDFSAADIQ
MSFPLEAMAARGALDNCPKLRGFLQRIHARPAYQRALEQGGPYDLLS
Download sequence
Identical sequences OsIBSD047530 39946.BGIOSIBSE038042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]