SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047606 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047606
Domain Number 1 Region: 273-421
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.67e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 139-196,223-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000794
Family Glutathione S-transferase (GST), N-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047606
Sequence length 425
Comment 425
Sequence
MMKKLEDTGYGKMGDAYAGTQQYMQSMGVPGFLLPLTILLEFGGGLAILFGFLTRTVALF
TAGFTILTALLFHTDFANEGPACRALSFFNSDTKEIPMGQLVDGVWQDIWYDTKSTGGRF
KRSTAQFRNWVTADGQPGEHGVGGFQAEAGRYHLYVSLACPWAHRTLLMRKLKGLEQIIP
VSVVHPLMLENGWTFGQDFPETTGDPLYHADFLYQIYLRADPHYSGRVTVPVLWDKQRQT
IVSNESADIIRMFNSAFDGVGARAGDYYPTALRGKIDELNGWIYDQVNNGVYKAGFATSQ
EAYDEAVNGVFNALERLEQILGQHRYLTGDRLTEADLRLWTTLVRFDPVYVTHFKCDKHR
ISDYLNLYGFLRDIYQMPGIAETVSLPHIRNHYYRSHATINPHGIISIGPAQDLDEPHGR
DQRFG
Download sequence
Identical sequences 39946.BGIOSIBSE038349 OsIBSD047606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]