SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047616 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047616
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.94e-82
Family BC ATP-binding domain-like 0.0000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047616
Sequence length 210
Comment 210
Sequence
MAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDRFLDDA
VEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQVQKLAFE
LQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGIPLAKVAARVMAGQTLAQQGV
TKEIIPPYYSVKEVVLPFNKFPGVDPLQLA
Download sequence
Identical sequences 39946.BGIOSIBSE038145 OsIBSD047616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]