SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047752 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047752
Domain Number 1 Region: 424-555
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.51e-37
Family Glutathione peroxidase-like 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047752
Sequence length 561
Comment 561
Sequence
MPQDAVARVLSVMGMITAGFLLFIIMTSNPFTRTLPNFPIDGSDLNPLLQDIGLIFHPPL
LYMGYVGFSVAFAFAIASLMAGRLDTAWARWSRPWTTAAWVFLTLGIVLGSAWAYYELGW
GGWWFWDPVENASFMPWLAGTALMHSLAVTEKRGTFKAWTVLLAITAFSLCLLGTFLVRS
GVLVSVHSFASDPARGMFILAYLVIVIGGSLLLYAVKGGQVRSRVQHETFSRETFLLGNN
VLLIAAMLVVLLGTLLPLVHKQLGLGSISIGEPFFNTMFTWLMAPLALLLGIGPLPADSV
DIHNYHFVFRDVHDIRGPNYSGGVGIIDVTRNGKPEATLHAEKRYYSVARSMMTEAAIDG
GFSRDLYAALGEELEDGSWARKLLFIPLVLFLLLVAALMVQLTRNAGGEDPTMLESALIG
KPVPTFRLESLDQPGKTYDQAVLRDGKPILLNVWATWCPTCRAEHQYLNTLAARGVRVVG
LNYKDDRAKAVTWLNSLGNPYALSLYDGDGMLGLDLGVYGAPETFLIDGQGIIRYRHAGD
MNERVWQQEVLPLYRKYGGEA
Download sequence
Identical sequences OsIBSD047752 39946.BGIOSIBSE038538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]