SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048099 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048099
Domain Number 1 Region: 396-697
Classification Level Classification E-value
Superfamily RmlC-like cupins 5.2e-102
Family Gentisate 1,2-dioxygenase-like 0.000000000299
Further Details:      
 
Domain Number 2 Region: 1-392
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-74
Family Glycerol-3-phosphate transporter 0.011
Further Details:      
 
Domain Number 3 Region: 771-901
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.98e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.00033
Further Details:      
 
Domain Number 4 Region: 693-774
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048099
Sequence length 904
Comment 904
Sequence
MLDGFDTAAIGFIAPDIRAQWQLSAGELAPLFGAGLLGLTAGALLCGPLSDRFGRKRVIE
LCVALFGALSLISAFSPDLQTLVVLRFLTGLGLGGAMPNTITMTSEYLPARRRGALVTLM
FCGFTLGSALGGIVSAQLVPRVGWSGILVLGGVLPLMLFAALLFALPESPRWQIRRQLPQ
KVIAKTVSAMTGEWDEETHFYLNEAATSAKGSISPLFAGRQLRITLMLWAVFFMSMLIIY
LLSSWMPTLLNHRGIDLRHASWVTAAFQIGGTVGALGLGVLMDKCNPFRVLAVSYALGAV
CIVMIGLSENGLWQMALAIFGTGIGISGSQVGLNALTATLYPTQSRATGVSWSNAIGRCG
AIVGSLSGGVMMAMNFSFDTLFFIIALPAALSTDVNPSRQQFYRQISGQNLTPLWESLHH
LVPSTPNANCAPAYWNYQEIRPHLLASGELIGAKEAVRRVLVLENPMLRGQAAITPTLYA
GLQLIMPGEIAPSHRHNQSALRFIVEGKGAFTAVDGERTQMHEGDFILTPQWRWHDHGNP
GAEPVVWLDGLDLPLVNLLGCGFAEDYPQEQQPVTRREGDYLPRYAANMLPLRHQKGNSS
PIFNYRYDRSRETLYDLTRMGDADEWDGYKMRYVNPVTGGYPMPSMGAFLQLLPKGFSSR
KARTTDSTLYHVVEGRGQVNIGNETLHFSAKDIFVAPTCSASYRVRIALALKGIHYQTVG
VNIRIGQQNELAYRRMNPVGLVPTLLTDDGESLSQSLAITDWLDRHFPQSPLLPTADPAR
SRVLEIVYVIACDIHPVNNLRVLRYLSEELKVSEEEKKRWYAYWIRQGLSAVEQLLLQRP
PGPFCVGDSPTLADCCLIPQWANALRMGCDMSGYPRCKAIYDACTQLPAFIAAAPENQQD
KISA
Download sequence
Identical sequences 39946.BGIOSIBSE038025 OsIBSD048099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]