SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048339 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048339
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.16e-31
Family Thioltransferase 0.0029
Further Details:      
 
Domain Number 2 Region: 584-678
Classification Level Classification E-value
Superfamily Ribosome binding protein Y (YfiA homologue) 3.01e-29
Family Ribosome binding protein Y (YfiA homologue) 0.00066
Further Details:      
 
Domain Number 3 Region: 101-234
Classification Level Classification E-value
Superfamily TPR-like 0.0000000253
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048339
Sequence length 687
Comment 687
Sequence
MEVPVLVDFWAPWCGPCKSLGPILEKLETEYAGRFKLVKIDSDQEQQIAGMFGIRSIPTC
VLMMNGQPVDGFMGAQPEGQVRAFLDKHVPSADELLAEAEEEAAQEALEDGDTDTALEKL
QHAVATDPANDDARFDYVKLLLQLGRVDDAKVAFAPVIAKAAGSRRLGALKVWMDAIDAA
EGAPDAAAAEAAFAQRISANKRDFDARFERARWLIARQRWTDAMDELLEILMRDKAWNDE
AARKTYVAVLEIIEPPRVKVAEGQIPPEDPVVATYRRRLSSVRIFIPSGGVFEVDVLDVT
DADAPPVIVGRQTLEEFERLPVTLRIPYRSAQVVPDRRYVVRAMVSVNGIAWMASEGVNP
LQRDPAYRHVDVLLQPLPRNAGTEQAAVPLAQTYWKLTEVDGMAVPPAPAGRPQAHLVVQ
PQEGRITGSGGCNPFIAAYEMSGAELRVGSIDSGLRLCFDTGLAEGLYLEALRAAEHYRI
EGRQLLLAREGGPGKEKILLRFEAPELRLKVPSGARPNSNLVSAMIMPFSRAIAAAASYS
AMLVSRIFVARSMPTISTMGCGRREAFVSPSGNCTPQTERLACGHHLEVTPALRSYVTGK
LDRISRHFDQVVDVKVLLTVEKQKEKEKRQRAECNVHVKGNDLFAESSHSDLYAAVDELV
DKLDRQVVRHKDRLQDHHCAIKRAQPA
Download sequence
Identical sequences 39946.BGIOSIBSE038299 OsIBSD048339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]