SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048374 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048374
Domain Number 1 Region: 6-113
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000249
Family Tyrosine-dependent oxidoreductases 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048374
Sequence length 125
Comment 125
Sequence
MEPGSIAERFRDRSILITGSTGFLAKMLVEKILRIQPDVRKLYLLVVGKGLFDVLREQHG
ASFHSFIKEKVCPLPGDITHQNFGLGNSEILRLSQDVDIIVNGAATTNFMERKVNETLNL
LENFL
Download sequence
Identical sequences 39946.BGIOSIBSE038860 OsIBSD048374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]