SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048473 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBSD048473
Domain Number - Region: 10-73
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000173
Family DsbA-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048473
Sequence length 287
Comment 287
Sequence
MAAFAPLFATLTVMGIEAQHRPAAYRAIIKENLNLADEKQLSAWLVANGIDEAAYQRTRD
SERVKELLAYMTAARNAVLMEHLAQCTSQLNQVVEPLHRAGVPVLLAPMHTVSDVLATLV
GAGVYPGRATVIVSGDAQTLARRAPEGEWRQRLDYCSIHDDPRHIAGTLSQALLEATEHR
RNIILFPDITPDYTLNSIRDASAKLACRLFNRPAHLHSGIVRLSRAMRARVVCYSLYYDR
GVRIHIEEPIATELVGRAVPEIVERTLWRHADDWLLWHSHSLFFINE
Download sequence
Identical sequences OsIBSD048473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]