SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048697 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048697
Domain Number 1 Region: 137-261
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.7e-43
Family Insert subdomain of RNA polymerase alpha subunit 0.000017
Further Details:      
 
Domain Number 2 Region: 94-137,262-316
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.08e-28
Family RNA polymerase alpha subunit dimerisation domain 0.00048
Further Details:      
 
Domain Number 3 Region: 1-96
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 3.93e-28
Family Ribosomal protein S4 0.0000724
Further Details:      
 
Domain Number 4 Region: 339-411
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 6.28e-27
Family C-terminal domain of RNA polymerase alpha subunit 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048697
Sequence length 417
Comment 417
Sequence
MGFGSTRAEARQLVSHKAITVNGQSVNIASYLVKPGDIVAVREKSKKQARIVEALQLAQQ
VGIPAWVEVNADKVEGTFKKAPDRDEFGADINESLITINVEQLGHNRAKVALEPFERGYG
HTLGNAIRRVLLSSMVGYAATEVTIAGVLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRD
EVTLSLRKDGEGVVTARDIQTPHDVEIVNPDHVIAHLSQGGKLDMQIKVEKGRGYVPGNL
RRYADESTKSIGRIVLDASFSPVKRVSYTVESARVEQRTDLDKLVVEIETNGAITAEDAV
RASAKILVEQLAVFAQLEGGELAAFDTPAGPRGSATFDPILLRPVDELELTVRSANCLKA
ENIYYIGDLIQRTENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDKR
Download sequence
Identical sequences OsIBSD048697 39946.BGIOSIBSE038426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]