SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD049424 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD049424
Domain Number 1 Region: 300-665
Classification Level Classification E-value
Superfamily TPR-like 1.09e-158
Family Transcription factor MalT domain III 0.000000000125
Further Details:      
 
Domain Number 2 Region: 688-754
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.07e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD049424
Sequence length 763
Comment 763
Sequence
MRFFLRHQPENLTLILLSRTLPPLGIANLRVRDQLLEMGTQQLAFTHQEAKQFFDCRLAA
PMEQQDSSRLCDEVEGWATALQLIALSARQSASSAQLSAKRLAGLNASHLSDYLVDEVLD
HVDADARAFLLRCSVLRSMNDALIVRLTGEDNGQQRLEELERQGLFIHRMDDTGEWFNFH
PLFASFLRQRCQWELALELPGLHRAAAEGWLALGYPAEAIHHALAASDVSMLRDILLQHA
WSLFHHSELALLEECLNALPYERLIQNPKLALLQAWLAQSQHRYSEVNTLLERAERTMRE
QKIEIDQTLHAEFDALRAQVAINAGKPEEAERLATEALKFLPLSSYYSRIVATSVTGEVH
HCKGELARALPMMQQTEQMARRHQANHYALWALLQQSEILIAQGFLQAAYETQDKAFELI
REQHLEQLPMHEFLLRIRAQILWSWSRLDEAEDAARAGLKILANYQPQQQLQCIAMLAKC
SLARGDLDNANTHLQRCETLLHGAHYHRDWLTNTDKSRVIHWQMTGDTAAAAQWLRHTEK
PGMADNHFTQGQWRNIARVQILLGQYEEAGVVLDELNENARRLRLVSDLNRNLLLSNQLY
WLQERKGEAQQALIEALSLANRTGFISHFVIEGEAMAQQLRQLIQLNTLPELEQHRAQRI
LRDINQHHRHKFAHFDENFVDKLLTHPQVPELIRTSPLTQREWQVLGLIYSGYSNDQIAG
ELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQQLLKMMGYGA
Download sequence
Identical sequences OsIBSD049424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]