SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD049504 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD049504
Domain Number 1 Region: 68-204
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.1e-40
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.65e-18
Family BC ATP-binding domain-like 0.0000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD049504
Sequence length 208
Comment 208
Sequence
MAGQSLASQGITEEVTPPYFSVKEAVFPFVKFPGVDTILGPEMKSTGEVMGVGKTFGEAF
VKSQLGAGTKLPTSGKVFLTVKNSDKPRAVAIARELAAMGFDLVATKGTAAAIADAGVPV
KVVNKVTEGRPHIVDMIKNDEIVMVINTVEERRNAIADSRAIRTSSLLARVTTFTTIFGA
EAAVEGMKHLQNLDVYSVQELHAQLTAA
Download sequence
Identical sequences 39946.BGIOSIBSE038554 OsIBSD049504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]