SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001531 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001531
Domain Number 1 Region: 152-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-39
Family PDI-like 0.0032
Further Details:      
 
Domain Number 2 Region: 31-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.19e-36
Family PDI-like 0.0042
Further Details:      
 
Domain Number 3 Region: 275-369
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.7e-29
Family ERP29 C domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001531
Sequence length 371
Comment 371
Sequence
MAIPRISPRKTLPLFAALALALAWAFAAPAFADGDDVVALTESTFEKEVGQDRGALVEFY
APWCGHCKKLAPEYEKLGASFKKAKSVFIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSL
EPKKYEGQRSAEALAEFVNTEGGTNVKLATIPSSVVVLGPDNFDSIVLDENKDILVEFYA
PWCGHCKHLAPIYEKLASVYKLDDGVVIANLDADKHKDLAEKYGVSGYPTLKFFPKGNKA
GEDYDGGRELDDFVKFINEKCGTSRDTKGQLTSEAGRIASLDALAKEFLGAANDKRKEIL
SNMEEEVVKLSGSAAKHGKVYIAIAKKILDKGHDYTKKETERLERMLEKSISPSKADEFI
IKKNVLSTFSS
Download sequence
Identical sequences A0A0D3END7 A0A0E0FLA2 A0A0E0MVU7 A2WPH9 Q942L2
XP_015622515.1.37577 LOC_Os01g23740.1|PACid:21907506 LOC_Os01g23740.1|13101.m02513|protein OsIBCD001531 39946.BGIOSIBCE001678 39947.LOC_Os01g23740.1 ONIVA01G16970.1 OBART01G14220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]