SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001737 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001737
Domain Number 1 Region: 74-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.64e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.04e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001737
Sequence length 226
Comment 226
Sequence
MAPMKVYGWVVSPWMARVLVALEEAGAEYEVVPMSRSGGDHRRPEHLARNPFGEIPVLED
GDLTLYQSRAIARYIFRKYKPEFLGLGEGGSLEESAMVDVWLDVEAHQHEAAVRPILWHC
IINKFEGRDRDQGVVDESVRKLEKVLGVYEARLSGSRYLAGDRISLADLSHFSNMRYFMA
TEYAGVVDAYPHVKAWWEALLARPTVQKVMAGMPPDFGFGSSGNIP
Download sequence
Identical sequences A0A0E0FLL8 A2WQ21
ONIVA01G17930.1 OsIBCD001737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]