SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001742 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001742
Domain Number 1 Region: 74-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.5e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.92e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001742
Sequence length 218
Comment 218
Sequence
MSPVKVFGRAISTNVSRVLVCLEEVGADYELVTVDFLAGEQNSPEHVERNPFGKIPALQD
GDLVLFESRAIAKYILRKYKSSEVDLLRESDIGEAALVDVWTEVEAHQYYPALSPIVFEC
IIFPIMRGVPTNQQVVDESLEKLKKVLETYEARLSASRYLAGDFLSFADLNHFPFTYYFM
ATPYASLFDAYPHVKAWWEGLMSRPSIKKISANMPTKF
Download sequence
Identical sequences A0A0E0G946 A2WQ27
OsIBCD001742 39946.BGIOSIBCE001875 ONIVA02G24990.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]