SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001743 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001743
Domain Number 1 Region: 74-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.69e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.52e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001743
Sequence length 219
Comment 219
Sequence
MTPVKVFGPAQSTNVARVLLCLEEVGAEYEVVNVDFTVMEHKSPEHLKRNPFGQIPAFQD
GDLYLFESRAIGKYILRKYKTREADLLREGNLREAAMVDVWTEVETHQYNSAISPIVYEC
IINPAMRGIPTNQKVVDESAEKLKKVLEVYEARLSQSTYLAGDFVSFADLNHFPYTFYFM
GTPYASLFDSYPHVKAWWERLMARPSVKKLAAVMAPQGA
Download sequence
Identical sequences A2WQ28 O65857
39946.BGIOSIBCE001876 39947.LOC_Os01g27360.1 OsIBCD001743 LOC_Os01g27360.1|PACid:21904196 XP_015632407.1.37577 LOC_Os01g27360.1|13101.m02844|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]