SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001746 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001746
Domain Number 1 Region: 2-44
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000162
Family Glutathione S-transferase (GST), N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001746
Sequence length 80
Comment 80
Sequence
MSTNVARVLVCLEEVGVEYELVNIDFKAMEHKSPEHLKRNPFGQDASFPGRGSASLRSVV
LLYSWTGVVNSWGDIMRTQN
Download sequence
Identical sequences OsIBCD001746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]