SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001753 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001753
Domain Number 1 Region: 74-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.35e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.48e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001753
Sequence length 221
Comment 221
Sequence
MSPVKVFGSAPFTNVARVLLCLEEVGADYEIVDVDFGAREHKGPDHLARNPFGQVPAFQD
GDLMLFESRAICRYILRKHRATDEANLLREGDPSESAVVDAWLDVEALRYEPSVHAVFVQ
RRVVPALGGEPDERVIAESVARLRETLAVYEARLEATRGYLAGGEVSLADLSHFPYTRYF
MEMPYAAPVFGAYPRVTAWWERLLARPSVRKVAAMMSGGEG
Download sequence
Identical sequences A0A0D9Y8M7 A0A0E0G942 B8A893
OsIBCD001753 ONIVA02G24960.1 39946.BGIOSIBCE001887 OGLUM01G18090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]