SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD002105 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD002105
Domain Number 1 Region: 110-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.76e-27
Family Thioltransferase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD002105
Sequence length 232
Comment 232
Sequence
MWATNGPQSLGMHLGVKLALRRPNGSHGEIDVVRLHQGSREIELRADRSSLMALLPMLLT
FYPWVMQFRNYSSGLGGDSTATGDSSSTRVAADPDTHQDFQPTTKSSNMSFDDIVSQDIK
ENPVLIYMKGYPDAPRCGFSALAVRVLKQYDVPISARDILGDLKLKESVKAHTNWPTFPQ
IFIKGEFVGGSDIILDMHQASELIVPGFHNHKGQLKDVLGDIAQKREQNESS
Download sequence
Identical sequences OsIBCD002105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]