SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD002981 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD002981
Domain Number 1 Region: 91-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.29e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 10-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD002981
Sequence length 237
Comment 237
Sequence
MAGRGGGGELRLLGTWSSPWVIRVRVALGMKGLSYEYTEEDLSSKSDLLLRSNPVHEKVP
VLIHGGRPVCESLVVLEYIDETWGATGTPQLLPADPYDRATARFWTNYVNDTFFPSWKVL
FRSTAAEQRAEAFKNVVPRVEALERAFGECSKGKAFFGGDDAGLVDVALGSHLVWIKVVD
EVAGANLLDEAKFPGLAAWAERFLAVDAVRQVMPDAGDVLKQYKGFLAKWTAGAGSS
Download sequence
Identical sequences A2WU02 I1NQV4
ORGLA01G0224400.1 39946.BGIOSIBCE003245 OsIBCD002981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]