SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD002987 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD002987
Domain Number 1 Region: 151-246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-30
Family B3 DNA binding domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 30-73
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000019
Family GCC-box binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD002987
Sequence length 330
Comment 330
Sequence
MAVGRGPRGKAARGPEGHDVAPRCPPTTSAIRKIYERHQRVWLGTFAGEDDAARAYDVAA
QRFRGRDAVTNFRPLAEADPDAAAELRFLATRSKAEVVDMLRKHTYFDELAQSKRTFAAS
TPSAATTTASLSNGHLSSPRSPFAPAAARDHLFDKTVTPSDVGKLNRLVIPKQHAEKHFP
LQLPSAGGESKGVLLNFEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDVVG
FYRSAASAGDDGKLFIDCKLVRSTGAALASPADQPAPSPVKAVRLFGVDLLTAPAPVEQM
AGCKRARDLAATTPPQAAAFKKQCIELALV
Download sequence
Identical sequences OsIBCD002987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]