SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD003578 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD003578
Domain Number 1 Region: 46-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.76e-22
Family Glutathione peroxidase-like 0.00091
Further Details:      
 
Domain Number 2 Region: 203-314
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.75e-21
Family Glutathione peroxidase-like 0.00065
Further Details:      
 
Domain Number 3 Region: 349-401
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000194
Family C1-like domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003578
Sequence length 410
Comment 410
Sequence
MEEARENGGVGGSVLPLASLISPTGNEPYMVQWSMNNLIKTQRKVYFSQVQISELEGKII
GLYFAANWYPKCEAFTPALTAAYHQLKEHGAGFEVIFVSCDENRPSFERFHRAMPWPAVP
FGDIGCKKRLSERFQVEGIPRLVVLAPNGEVVQPDAVELVHRYGDRAFPFTSARVAELEA
DEQRKFASQTLEKIFSVNGKDYVNGSQEQVPISSLVGKTVGLYFSAHRCAPCIKFTAKLA
AIYSNLKGKAEDFEIIYIPMDKEEDGYLRSCSDMPWLALPYDDGASSGALARYFDVREIP
TLVVVGPDGKTVTREGRNLVNLYFDMAFPFTDEQIRLLQEMEDEDAKGYPPSLRHTGHRH
ELSIVSDKSGGGPYICCECDEQGLGWAYQCIACGYEIHLRCGRDMEGRAE
Download sequence
Identical sequences OsIBCD003578 39946.BGIOSIBCE003922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]